PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016433393.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 325aa    MW: 37835.1 Da    PI: 8.7298
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016433393.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.44.9e-15345244
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                     i+n++ r+ t+ kR++ + KK +ELS+LC+++ ++i++++++
  XP_016433393.1  3 LIKNERSRNSTYQKRKKSLEKKSNELSILCQVKLCMIVYGPKD 45
                    59**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.09E-15184IPR002100Transcription factor, MADS-box
CDDcd002667.83E-16155No hitNo description
PROSITE profilePS5006613.75144IPR002100Transcription factor, MADS-box
SMARTSM004326.4E-8153IPR002100Transcription factor, MADS-box
PfamPF003193.9E-15445IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MELIKNERSR NSTYQKRKKS LEKKSNELSI LCQVKLCMIV YGPKDSEPTI WPDKDTVLSL  60
IYSYRARSDD DKRLRTHDLS FYFRDLTRKV EIESSKLRKR NFEAKYPTWD QHYDSLSSDQ  120
LKQLSALLGA KIEFMKQRLE LLKGTQTISL EDMHAMSFLG KQVTQPNTQC VMQSLVRISS  180
LQLEIIEQQQ QQLVPPLNFP ETEIMPFGQH QIIQRDNHQS SGISTGIPHC TGTGYEPHLA  240
ILNASGNVIE SQRCVTGIWP EIIICCLAIM LINNLNHCVI LFQWRHLITT FISIILCCQM  300
LQLLIKCILL RRKSIMKWEI FNYQI
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBA0000421e-33BA000042.1 Nicotiana tabacum mitochondrial DNA, complete genome.
GenBankKM2076791e-33KM207679.1 Nicotiana tabacum/Hyoscyamus niger cybrid clone contig2 mitochondrion, complete sequence.
GenBankKR0711211e-33KR071121.1 UNVERIFIED: Nicotiana tabacum strain ms zhongyan100 mitochondrion sequence.
GenBankKR7800361e-33KR780036.1 Nicotiana tabacum cultivar zhongyan 100 mitochondrion, complete genome.
GenBankKT9979641e-33KT997964.1 Nicotiana sylvestris cultivar TW 137 mitochondrion, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016433393.10.0PREDICTED: agamous-like MADS-box protein AGL92
TrEMBLM1CP541e-94M1CP54_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000716823e-94(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24572253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.11e-08AGAMOUS-like 82